PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30169.m006454
Common NameRCOM_1578350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 305aa    MW: 34062 Da    PI: 4.8119
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30169.m006454genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-142673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
    30169.m006454 26 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 73
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.212177IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-222176IPR009057Homeodomain-like
SMARTSM007171.3E-92575IPR001005SANT/Myb domain
PfamPF002492.7E-132673IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-1928100IPR009057Homeodomain-like
CDDcd001671.81E-82973No hitNo description
PROSITE profilePS500903.89274102IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-77799IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MRKPEASGKN SNVNNNNINN TNKLRKGLWS PEEDDKLMNY MLNNGQGCWS DVARNAGLQR  60
CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSLLGNS LYIFFIHASP NTSDSSSEPS  120
KEATIGGFIS MQEQGMNPMY MDPSLSSSAS TSSATCMQTM FLNHMMDPSP TFNHGISMYG  180
ASVYFNNAAP CITTQIGDDH LYGNYQGMLE GVNIGIEGEF HIPPLESISI EENVKTENIY  240
GGDTNKHPYS DVNRISSNCK NYNRAENMAA AVGNFWQGEE LKVGEWDLEE LMKDVSSFPF  300
IDFSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346626e-75KM034662.1 Jatropha curcas clone JcMYB042 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571138.10.0PREDICTED: transcription factor MYB46
TrEMBLB9RID90.0B9RID9_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0001s26590.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-38myb domain protein 46